SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113475641|ref|YP_721702.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|113475641|ref|YP_721702.1|
Domain Number - Region: 764-823
Classification Level Classification E-value
Superfamily FtsH protease domain-like 0.017
Family FtsH protease domain-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113475641|ref|YP_721702.1|
Sequence length 891
Comment hypothetical protein Tery_1978 [Trichodesmium erythraeum IMS101]
Sequence
MPTYNIHEFSTGINVETLPDSSWRSRGYKVGEYMNSTLPQIPYVVQLAIANKMFEVSKDS
HSQKPTFVGREVRGKNADPAWSVVAVVTPGRDDYGLFNSFYRYILCQGVDRLWVILDAID
NYSQKYGRLPIFNPSEIKEIGKPNYHNISNKPLVTLPSELNSLTSNYQRALILQPGQVSD
LQTINAVAEKIANGQLVSWAYDVEAVERARRFLVIQAADEKAYQDLIRIGNASIDNLSSV
DEPSIELAIKGLIGGSQIKQEWIQALLQNEQVTSDHCQTIFDDQGAHTRIKQRNYSPQMV
RLLTLRAIIIPDTLPEYLEWFGIDGKNKGKGDNKQKVSLEFQGQLKKHILQLEPLIDGSM
KSVLEQILKKKISIPAFSWLLTAQKSLWSSYRASLLQNVRDDLEAIDNYLNSSDDSPSEP
SFACGDSIWKNLQSGLPGPNYRYSYYQPFADLFERLGDYQLASYFYQVSKGVVPKNLFLK
AFKNKDKSDLWGLTLNREVTWDEHLINLLRRYSLSLAAIFILVLTNLFSYMLGLQSKGKI
GLKNSNGETLEQAREAGEQEGYDKGYQVGYQEGLNAARQVEIIPPMTKASSEFSTTATVM
EALVKRLTNQLTEKFNQADPQIMRNQVIKEIKAIIGNPNLDYSSAIQGNENHKKQLIEAI
YWYQANTGEKGYGYIDDNFETDERIEKEVNNTLLFNFANRTKPALEKLIEELLQDNSLRQ
KNIDRIQIINAIKNTFVGITDYTATIEEGKPKEVEKFVNSIQQYQNGGDGIINYGKQTYQ
RLKEEIKTQYEERFNFANKTKPALEKLIEELLEDENLRQEKFDRSQIINAIKNTFVGITD
YAGAIEKGNPQEVEKFVNSIREYQNGGDGIIHYSEETYQRLKQDIQRQLLE
Download sequence
Identical sequences Q113U5
gi|113475641|ref|YP_721702.1| 203124.Tery_1978 WP_011611602.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]