SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113475716|ref|YP_721777.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475716|ref|YP_721777.1|
Domain Number 1 Region: 205-401
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.4e-68
Family B3/B4 domain of PheRS, PheT 0.00000817
Further Details:      
 
Domain Number 2 Region: 36-195
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.37e-44
Family Myf domain 0.002
Further Details:      
 
Domain Number 3 Region: 495-706
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.18e-42
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00013
Further Details:      
 
Domain Number 4 Region: 718-816
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.45e-29
Family Anticodon-binding domain of PheRS 0.00045
Further Details:      
 
Domain Number 5 Region: 417-502
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000714
Family Domains B1 and B5 of PheRS-beta, PheT 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113475716|ref|YP_721777.1|
Sequence length 817
Comment phenylalanyl-tRNA synthetase subunit beta [Trichodesmium erythraeum IMS101]
Sequence
MRISLKWLEELVDINITPEELAETLTMAGFEVEEIEDRSTWSAGVVLGKILEADKHPNAN
KLKVCQVDIGKSDPLNIVCGASNATADIYVPVATIGTYLPAIDLKIKKSKLRGVHSEGMI
CSLSELGLTKDSEGIHIFDLENPELGSDVGPLLGLDDVILDLTTTANRADALSMIGVARE
VAALTGASLRIPDVSEILIPDEEGDSSIKIDISASSACPIYIGTVIEGVKIGPSPKWLKE
RLEATGIRAINNVVDITNYILLEWGQPLHGFDQDKIQQIIGHKLLTIGVRYANENEELIT
LDSQKRTLETETLLITANEKPVALAGVMGGEETEVSDQTTNLLLEAAIFAPIAIRRSARS
QGLRTEASTRFERGVNTAELVLACSRAIHLITELAGGKVSYQDTFTTKADSITATRKLSL
SLERINAILGPLKPSENTLDESFLQPEAVEGILKSLGCELSKIEAKGAVGWNVTVPAYRY
RDLEREIDLIEEVARLYGYDNFCETLPSKSAAGYLPPGELAVRSIRAALRGAGLTELMHY
SLVKQGGENQIAIANPLFVEYSALRTELLTGLIDAFQYNLEKGNGALNGFEVGRIFWNEV
EKYQEAEAIAGVISNGSKSWTRGGQEQPLSWFEAKGILEQVFERLYLKVEYKAYSENSLL
HPGRTASLWLQGKYLGIFGQLHPQVRQERELPDEVYVFQLDLGVLVSVMTQGNIWKRKFS
SYSTFPPAARDIAFFVTVGVSVDDIKQVISRAAGKLLESIELFDEYQGENVPDGERSLAF
RLIYRVGDRTLTDADVDPLQQKVRDALVDKFKVNLRS
Download sequence
Identical sequences Q113M0
gi|113475716|ref|YP_721777.1| WP_011611675.1.43450 203124.Tery_2063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]