SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113475747|ref|YP_721808.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475747|ref|YP_721808.1|
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 1.06e-38
Family Bacterial S-adenosylmethionine decarboxylase 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113475747|ref|YP_721808.1|
Sequence length 138
Comment adenosylmethionine decarboxylase [Trichodesmium erythraeum IMS101]
Sequence
MKQLGTHLVVDAWHSPTELLNDTEFIRQSLMKAISAGGATLIDLCVHQFSPHGVTATATL
AESHIAIHTWPELGYFAADLFFCGHGSPHKAIEILQTALQAKQMKLTEIKRGFEQEMAVQ
DTVTTHHNAKTLAKINFS
Download sequence
Identical sequences Q113I9
gi|113475747|ref|YP_721808.1| WP_011611706.1.43450 203124.Tery_2096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]