SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113475839|ref|YP_721900.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475839|ref|YP_721900.1|
Domain Number 1 Region: 3-200,231-314
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 3.14e-86
Family ATP synthase (F1-ATPase), gamma subunit 0.0000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113475839|ref|YP_721900.1|
Sequence length 314
Comment F0F1 ATP synthase subunit gamma [Trichodesmium erythraeum IMS101]
Sequence
MPNLKAIRDRIKSIKNTKKITEAMRLVAAAKVRRAQEQVIGTRPFADRLAQVLYGLAERL
QFESLDLPLLQKREAKTVGLLVISGNRGLCGSYNTNVIKRAEMRARELTQQGINCQYVLI
GRKAIQYFQRREVPILNTYDNPEKIPTADNASVVADEILAGFMAGSIDRVELIFTRFISL
ISSKPVIQTLLPLDPQGLEVKDDEIFRLTSKGGEFEVSRETVSAAVKSFPRDMIFEQDPI
QILDALLPLFLTNQLLRAWQESSASELASRMTAMSNASDNASELAGTLTLAYNKARQAAI
TQEILEVVGGANAL
Download sequence
Identical sequences Q112Z7
WP_011611796.1.43450 203124.Tery_2198 gi|113475839|ref|YP_721900.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]