SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113475920|ref|YP_721981.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475920|ref|YP_721981.1|
Domain Number 1 Region: 4-245
Classification Level Classification E-value
Superfamily Hsp33 domain 3.66e-69
Family Hsp33 domain 0.00000382
Further Details:      
 
Domain Number 2 Region: 234-293
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 9.16e-20
Family HSP33 redox switch-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113475920|ref|YP_721981.1|
Sequence length 311
Comment Hsp33-like chaperonin [Trichodesmium erythraeum IMS101]
Sequence
MADQLIRAMAAEGGIRAVGVITTRLTEEARQRHKLSWVASVVLGRTMAAGLLLASSMKTP
ESRVNIRVQGNGPLGEVLVDAGLDGTVRGYVNNPTIELLPNKIGKHDIGKAVGNQGYLYI
VRDIGYGYPYSGTVELVSGEIGDDITHYLAKSEQTPSALVLGVFVDKEGVQTAGGILLQV
MPKVAIDEELVQVLESRIASLSGFTSLLHSGKTLPEIFQELLGDMGLNILPEAQIVRFKC
DCSMEKVLRALRMFGVDELQNMIEEDKGAEVTCEFCSQLYQASPKELTQIIQDLQQPSTE
VPLGQLRRSSH
Download sequence
Identical sequences Q112R6
gi|113475920|ref|YP_721981.1| WP_011611876.1.43450 203124.Tery_2283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]