SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113476010|ref|YP_722071.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476010|ref|YP_722071.1|
Domain Number 1 Region: 315-512
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 3.92e-45
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000566
Further Details:      
 
Domain Number 2 Region: 805-1025
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 7.85e-43
Family Multidrug efflux transporter AcrB transmembrane domain 0.00015
Further Details:      
 
Domain Number 3 Region: 42-135
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 4.19e-23
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.003
Further Details:      
 
Domain Number 4 Region: 138-184,290-342
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000000000000575
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0079
Further Details:      
 
Domain Number 5 Region: 576-669
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000000000000214
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0063
Further Details:      
 
Domain Number 6 Region: 186-269
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000000000000902
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0099
Further Details:      
 
Domain Number 7 Region: 718-807
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000654
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113476010|ref|YP_722071.1|
Sequence length 1044
Comment acriflavin resistance protein [Trichodesmium erythraeum IMS101]
Sequence
MSFHLSAWSIKKPVPTLVMFLVLTVVGLMSFFQLGIDNLPNIDIPLVSVTVTQQGAGPTE
LETQVTKKVEDAVAGLGDIEQLKSTVTDGLSTTVISFDLGVDSDRATNDVRNAIDKIRQD
LPPDVNDPIITRIEIGGDGPIMTYAVASDKRSVEELSELVDKEISRAILNVPGVSQINRI
GGADREILIELSPQRLESLGITATQVNDQIRALNANIPGGRSQTGGTEKNIRTLGSAETV
EALKEYQIILPSGGAVPLSSVGKVIDGFEETRQTAWLLEKNSEGKALGSEQNLVRNNIGK
PVVAFGVVRSTGSTLVTVEKNVRKTVAKLEKTLPEDVDLQLIFTLATDIEQSYQASIDAL
VIGSILTVIIVGIFLRDWRPTIVTAVALPLSILPTFLVMRALNYTLDGMTLLALALAMGN
LVDDAICMIENIEQHINKGKNPFQAALDGSAEIGLAVVATTATIVAVFLPVAFMGGIPGK
FFKPFGITVAVATMFSTLVATTMTPMLGARLLKHRRLKTSPGFPEHNYKQRKFRPYSQLL
NWALRHKIITLAIAVIFFISSLQLIPLLPKGLTGAEDRGVSIVSLELSPGSTLAETEQAT
QQIMQLLQENQVVTSVFANVGSEFVNKSRLYVTILPRKERNFSQKEFEKQARPLFQNIPG
ARINFVSMGAGGTGKDLTIVLNSDNAVTLQQTSDALERQMREVPGLVDVTSSASLVKPEI
LIQPLPARAGDLGVSVQAIARTASLATIGDNEKNLAKFDLADRQIPIRVQLAEEFRNDLD
VIKNLRIPSKNGRLVPLSAVAEISVGSGPAQIKRFNRYRQVSFGANLQGISLGDALTEVK
SLPAINPLPLDISEQSDGSAKLMMDVFNGFASALGLSVLCIYAILVLLYNNFLYPIVILV
ALPLSIGGALLGLLIFQKELGLFALIGIVLLMGLVTKNAILLVDCSLANEEKGMARFHAV
REAGISRLRPILMTTFSTMAGMLPIALELGAGGPVRSPMAIAVIGGLTVSTLLTLVVVPV
LFSYVDLVAKNYENHIKVQSYSSK
Download sequence
Identical sequences Q112H6
gi|113476010|ref|YP_722071.1| 203124.Tery_2378 WP_011611965.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]