SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113476076|ref|YP_722137.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476076|ref|YP_722137.1|
Domain Number 1 Region: 33-244
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 1.7e-24
Family Isochorismatase-like hydrolases 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113476076|ref|YP_722137.1|
Sequence length 247
Comment isochorismatase hydrolase [Trichodesmium erythraeum IMS101]
Sequence
MTTTLATPDTSLATIQAALPIDPQPYIIADRPTGLIVVDVLNGFCTVGFGPLAPQEPNEQ
IATMVSESDRLARTFVEKGWPVLAFLDTHEPGKPEPPYPPHCEKGTGEEELVPELQWLHD
NPLATLVFKDCINGFIGSIDIDTQGNVLLDWINKNKLEALVVVGICTDICVMDFVVTILS
VRNHGLAPTLKDVAVYDQGCATFDMTAQMAAEKGLPKTAIHPQKISHHVGLYTMAERGAF
IASTIKL
Download sequence
Identical sequences Q112B0
WP_011612028.1.43450 203124.Tery_2452 gi|113476076|ref|YP_722137.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]