SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113476077|ref|YP_722138.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476077|ref|YP_722138.1|
Domain Number 1 Region: 1-200
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0000000000305
Family Tyrosine-dependent oxidoreductases 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113476077|ref|YP_722138.1|
Sequence length 271
Comment hypothetical protein Tery_2453 [Trichodesmium erythraeum IMS101]
Sequence
MNTQLAIVTGAGGAVGSCYLKHFLKQENTKCVALSRSHLETTDVIQFKVDLLDEKRTREA
IKQLDLSEVNDLILVHGVGKFKYEDLKSLPHLNQERHKIDDEVFSSNYHTFVNVVNPLVE
KLNEEHQRGRKTTLALCGFGSISDKYKIPFWHSYTYAKDTLRQYIKDLAKSEEWQGLIRG
RFINVSTTDTGNENKLRPNVTHEEKQYWLKPEKIVFQSMAVIESLQPLWQEIDVFEILPG
FNPEEYYNDYQTIKEKWQRQMALTKVDECLI
Download sequence
Identical sequences Q112A9
gi|113476077|ref|YP_722138.1| WP_011612029.1.43450 203124.Tery_2453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]