SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113476267|ref|YP_722328.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476267|ref|YP_722328.1|
Domain Number 1 Region: 251-413
Classification Level Classification E-value
Superfamily CinA-like 6.67e-52
Family CinA-like 0.00011
Further Details:      
 
Domain Number 2 Region: 1-205
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 4.45e-39
Family MoeA central domain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113476267|ref|YP_722328.1|
Sequence length 425
Comment competence damage-inducible protein A [Trichodesmium erythraeum IMS101]
Sequence
MIAEIICVGTELLLGDILNSNAQFLAKQLANLGIAHYYQTVVGDNPDRIKQVLAIATDRS
QILIFTGGLGPTPDDLTVATIADFFETPLIERPEIIEDITKKFARRGRIMTASNRKQALI
PQGANILPNPIGTAPGIIWQPVQNITIMTFPGVPTEMKSMWQETAIPYMQSQGWCEQTIY
SRTLKFWGITESSLAEKVAPFLEKENPTVAPYANYGEVKLRISARATSLELANKLIIPVE
EEIKDIAGIDFYGINDESLASVVGKLLLESGETLAVAESCTGGSLGSMLTSIPGSSEYFY
GGVISYENQVKITLLDVNLEDLMAEGSVSHVVAKQMASGVVKKLGTNWGISITGIAGPGG
GSDTKPVGLVYIGIARYDDIVESFEYRFSNLRDRNWIRRVSVSTALDLLRRKLYLSKQRP
QHHQA
Download sequence
Identical sequences Q111G9
gi|113476267|ref|YP_722328.1| 203124.Tery_2662 WP_011612217.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]