SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113476342|ref|YP_722403.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476342|ref|YP_722403.1|
Domain Number 1 Region: 211-326
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 8.89e-32
Family DRTGG domain 0.0003
Further Details:      
 
Domain Number 2 Region: 7-222
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.38e-26
Family Nitrogenase iron protein-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113476342|ref|YP_722403.1|
Sequence length 357
Comment hypothetical protein Tery_2747 [Trichodesmium erythraeum IMS101]
Sequence
MPKSANYLLIGSTEAYSGKSTIAIGLAHKLQEQGIAIGYGKLLGNCLATRSISTDADVQF
VTDTLKLSDNSIQPTLLMLNESIINKRLLAEEKTDYQKSLTQYLQVKGENLVILEGPSNL
DEGSLFELSLPQVSEILNSAVILVTRPNSHSYIDSLLSAKQRLGNSLIGVIINDVPLPAQ
ETVTTLVKPFLEARNIPVLGILPRSNLLRSVTVEELVKQLKAHVLCRSDRLDLMVESLTI
GAMNVSSAIKYFRKATNMAVVTGGDRTDIQLAALETSTHCLILTGQLSPDELVLSRADDA
EVPVLSVEYETLSTVEIINRAFGSVRLHEPVKVEFVKKLIAQHFDFERLLSHFQLGV
Download sequence
Identical sequences Q110Z4
203124.Tery_2747 WP_011612291.1.43450 gi|113476342|ref|YP_722403.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]