SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113476377|ref|YP_722438.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476377|ref|YP_722438.1|
Domain Number 1 Region: 6-124
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000627
Family Psq domain 0.086
Further Details:      
 
Weak hits

Sequence:  gi|113476377|ref|YP_722438.1|
Domain Number - Region: 201-298
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000185
Family Retroviral integrase, catalytic domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113476377|ref|YP_722438.1|
Sequence length 345
Comment transposase [Trichodesmium erythraeum IMS101]
Sequence
MNIIDKLNDFINQTKESKEIKRALAVKMTLSGKSYHEVKELLNVSHSFISEWKNQALFHG
VESLRLQYQGRQGYLKTVEKEKTIEWLRAQDYLRLSDLKNYLQEQYDVVFESNQSYYNLF
KEAGISWKKTQKKNPAKNDELVEVKRKEIEEFLAKWQPEIETGKLTVFMIDECHLLWGDI
LGYAWGKTDERIEIAIKNEKERQTYYGALDYKTKEFLVQEYESGNTKNTIEFIKYLQKQR
PGNKLAIFWDGATYHNSQEFREYLMTINQYLSEEELLINCTRFAPNAPEQNPVEDIWLQT
KNFSITFYHLCSSFKVVKWLFKFFADGQIFNFPKLFQYKILPQPT
Download sequence
Identical sequences Q110V9
WP_011612326.1.43450 gi|113476377|ref|YP_722438.1| 203124.Tery_2784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]