SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113476388|ref|YP_722449.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476388|ref|YP_722449.1|
Domain Number 1 Region: 246-336
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.0000000000000206
Family Barwin 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113476388|ref|YP_722449.1|
Sequence length 342
Comment rare lipoprotein A, partial [Trichodesmium erythraeum IMS101]
Sequence
MKHKIWTGLMTFLMFSHVGATYCYTYVLREGKTDQPNEPIDRNLETHDNLPKTFANSQTD
ILKVRKLRFNTKKEPNSITKIKAHELLDRQAATLYVRNIPVLTFLDSDKTNKKADHQGSN
SAAKAATIQCCNSNKQKDPLSEALVVASRLDQFIQESPNLKITAKWDADTKGYIILANDQ
KLVEINEQTILPDTTNDLAIDTLQATNRLRRQVNNAPPLKEIGGKPQLLPQPKAKKVAPK
PIQFQFQGWASWYGPGFHGRLSANGERFNQYAMTAAHKTLPFGTKVRVTNLHNGSSVIVR
INDRGPFIPGRVIDLSSAAADVLDMIQIGVAPVKVEVMARES
Download sequence
Identical sequences Q110U8
203124.Tery_2800 gi|113476388|ref|YP_722449.1| WP_011612337.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]