SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113476402|ref|YP_722463.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476402|ref|YP_722463.1|
Domain Number 1 Region: 625-716
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000000116
Family Collagen-binding domain 0.0049
Further Details:      
 
Domain Number 2 Region: 271-357
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000127
Family Collagen-binding domain 0.0035
Further Details:      
 
Domain Number 3 Region: 394-476
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000235
Family Collagen-binding domain 0.0083
Further Details:      
 
Domain Number 4 Region: 506-593
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000706
Family Collagen-binding domain 0.0054
Further Details:      
 
Domain Number 5 Region: 118-238
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000889
Family Collagen-binding domain 0.01
Further Details:      
 
Weak hits

Sequence:  gi|113476402|ref|YP_722463.1|
Domain Number - Region: 1606-1701
Classification Level Classification E-value
Superfamily Cadherin-like 0.000314
Family Cadherin 0.052
Further Details:      
 
Domain Number - Region: 1708-1801
Classification Level Classification E-value
Superfamily Cadherin-like 0.000455
Family Cadherin 0.075
Further Details:      
 
Domain Number - Region: 1413-1507
Classification Level Classification E-value
Superfamily Cadherin-like 0.000487
Family Cadherin 0.081
Further Details:      
 
Domain Number - Region: 1315-1409
Classification Level Classification E-value
Superfamily Cadherin-like 0.000487
Family Cadherin 0.081
Further Details:      
 
Domain Number - Region: 1920-2017
Classification Level Classification E-value
Superfamily Cadherin-like 0.000502
Family Dystroglycan, N-terminal domain 0.077
Further Details:      
 
Domain Number - Region: 1117-1213
Classification Level Classification E-value
Superfamily Cadherin-like 0.00235
Family Cadherin 0.069
Further Details:      
 
Domain Number - Region: 2018-2111
Classification Level Classification E-value
Superfamily Cadherin-like 0.00675
Family Cadherin 0.042
Further Details:      
 
Domain Number - Region: 939-1020
Classification Level Classification E-value
Superfamily Cadherin-like 0.00847
Family Cadherin 0.062
Further Details:      
 
Domain Number - Region: 1217-1311
Classification Level Classification E-value
Superfamily Cadherin-like 0.0124
Family Cadherin 0.074
Further Details:      
 
Domain Number - Region: 1511-1605
Classification Level Classification E-value
Superfamily Cadherin-like 0.0149
Family Dystroglycan, N-terminal domain 0.085
Further Details:      
 
Domain Number - Region: 831-921
Classification Level Classification E-value
Superfamily Cadherin-like 0.0173
Family Cadherin 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113476402|ref|YP_722463.1|
Sequence length 2334
Comment peptidase-like protein [Trichodesmium erythraeum IMS101]
Sequence
MFETGDINVNKIDDPLVPLEGQSDVEQIITSSSTSNIEHNFLGLSSESELLDTAESLSKS
TETTVEKTEIITPGDVKGTEKEDIDTITGEALKNLNVTPLEEDLLTKTRITNRKRSKKID
PGSDAENAHDLDKIGKSPTTYNEKIGYRSGGSRDKSDYYKFTLQGQKKQKFNDLNIVLDG
LNANANIQLFDEDGKTIIDQSRKKGKREEEINQILNNGTYYLNVQAQGKAKTQYSLSLSS
DQVKDEDGKRKDAQDLGSLKKKPQRIKDDIGFQLGSVRDQKDFFEFSVNRDSEVTITLDA
LKEDANLKLLNKQGSLLFSSSNENREKEKINTILEKGKYFVEVAPESGDRTNYMLSLSAD
DEIEDPDGQIPGKNLGKLTSKTISKTDRIGSQRGFIDSDDFWEFQLTKETDLTINLDSLK
ANADLELYDSDGTTLIFSSKNEGREEEEIEAILEKGIYYVRVKSVGGSSTKYRLSLSGDT
DITEEDDKLPGTSLGELGAEEVTQRDRIGFGRGSLRDFQDYYSFSLGEKSDVNISLDNLR
ANAELELLGIDGRTIEKSNKKGRASETIDSILAPGDYYVKVSPVGKAKTKYDLGLTANPA
IDDYSNPKQAKEIGILYEENTYEETNEIGFKRGSVRDFADYFHFELAQSQQVNISLDNLR
KNAGLQLLGGENGKKQIEISNEKGRQPEEINKDLEPGNYYVKVFSVGKLKTGYELSFEAL
SPDEAPYVVAPGIEDVKVKEDRNIRPFNVSKFFKDPDSRIETIEVTDNTNPGLVIPSEKN
KNLKGKKLELELVKNQNGYGEITITATSKGKTVSDTFAVDVTPVDDPPKLKLPIDNVNVD
EDAPKKEITLSNHFEDIDSDLTYKVINNNNGSLLSPSINGNTLTLEFSKDQNGEAKIKVQ
ATGDGKSVTDTFTVNVDPVDDPLFVDKPRENLSVEEDNPNEVIDLSKVFKDIDSQITLAF
SDDNNTNQNLVKATLDSESQTLSLNFEADQHGEADVTVTANSDGKPVEDSFTVTVAPVDD
PPRLIKEINDLNVLEDADNTNINLSEHFEDVDSVINYSVVANNNTGMVKDSANGNILNLD
YVQDKYGSGDITVRAESNGLSVEDTFTVNVAPVDDPPKVVNPIADVSVNEDAPATSIDLS
NVFSDIDNEDAAITKAVITNSNSGLVTPVIDGNNLSLNYIPNASGIAEITVEGTSNGLTV
SDTFTVNVAPVDDPIVVVNQIADVSVNEDAPATSIDLSNVFSDSDNEDAAITKAVITNSN
SGLVNPVIEGNNLSLNYIPNASGMAEITVEGTSNGLTVSDTFTVNVAPVDDPIVVVNQIA
DVSVNEDAPATSIDLSNVFSDSDNEDAAITKAVITNSNSGLVNPVIDGNNLTLNYMPNAS
GVAEITVEGTSNGLTVSDTFTVNVAPVDDPIVVVNQIADVSVNEDAPATSIDLSNVFSDS
DNEDAAITKAVITNSNSGLVNPVIDGNNLTLNYMPNASGVAEITVEGTSNGLTVSDTFTV
NVAPVDDPIVVVNQIADVSVNEDAPATSIDLSNVFSDIDNEDAAITKAVITNSNSGLVNP
EIEGNNLTLNYIPNASGVAEITVEGTSNGLTVSNTFTVNVAPVDDPPVVVNPIADVSVNE
DAPATSIDLSNVFSDIDNDDAAITKAVITNSNSGLVNPVIDGNNLTLNYIPNASGVAEIT
VEGTSNGLTVSDTFTVNVAPVYDPPDYPPVVANPIADVVVNEDAPATYIDLSNVFTDIDN
DDADITKAVITNSNSGLVTPVIDGNNLSLNYIPNASGMAEITVEGTSNGLTVSDTFTVNV
AVTTGRSSWEGTLGSDDDDNPTRNGKYYDDYLLNGVSPGEQVTVDMTASFDTYLQLVNAA
TGEVIAYNDDGGSGANSSLTFTVESNINYLIRSTSYSSGATGVYTVETSRGLMILRDDVP
PVVANPIADVVVDEDAPATSIDLSNVFSDIDNEDAAITKAVITNSNSGLVTPVIDGNNLT
LNYIPNASGIAEITVEGTSNGLTVSDTFTVNVAPVDDPPVVVNPIADVSVNEDAPATPID
LSNVFTDIDNDDAAITKAVITNSNSGLVTPVIDGNNLSLNYIPNASGMAEITVEGTSNGL
TVSDTFTVNVAVTTGRSSWEGTLGSDDDDNPTRNGKYYDDYLLNGVSPGEQVTVDMTASF
DTYLQLVNAATGEVIAYNDDGGSGANSSLTFTVESNINYLIRSTSYSSGATGVYTVETSQ
GLMIPSIAPSQSLNGYLGSSTQDNPTRNGKYYNDYLLTGVSPGEQITLNLSADFDTYLQL
VNAQTGELITYNDDGGSGTNSSLTFTVESNINYLIRATSYAPAQTGVHTLSVLR
Download sequence
Identical sequences Q110T4
203124.Tery_2814 gi|113476402|ref|YP_722463.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]