SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113476712|ref|YP_722773.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476712|ref|YP_722773.1|
Domain Number 1 Region: 103-257
Classification Level Classification E-value
Superfamily alpha/beta knot 7.19e-46
Family SpoU-like RNA 2'-O ribose methyltransferase 0.00035
Further Details:      
 
Domain Number 2 Region: 1-99
Classification Level Classification E-value
Superfamily L30e-like 5.18e-24
Family RNA 2'-O ribose methyltransferase substrate binding domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113476712|ref|YP_722773.1|
Sequence length 261
Comment tRNA/rRNA methyltransferase SpoU [Trichodesmium erythraeum IMS101]
Sequence
MLTSLQNSLVKQIRQLHQSKGRQEQQLFLVEGTHLLEEACKRNYPLITVCHTFEWQEKHK
FLYELVSQKAQRIELVSTKIIQSLATTVSPDGVVAIAPQSQTNFLKITTLGIVLDKIQDP
GNLGTIIRTAVATNIDGLFVSRDSVDLSHPKVVRASAGEWFNLHKAISENLKNEILKLQS
QGLQVLATVPNSNINYWEIDLRKPTIIVLGNEGSGISKDLIDLADYSVKIPLSNGVESLN
VAVSAAIILYEIQRQRQLELK
Download sequence
Identical sequences Q10ZM4
gi|113476712|ref|YP_722773.1| 203124.Tery_3173 WP_011612646.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]