SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113476724|ref|YP_722785.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476724|ref|YP_722785.1|
Domain Number 1 Region: 1-308
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.89e-75
Family Cytidylytransferase 0.012
Further Details:      
 
Domain Number 2 Region: 246-432
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 5.18e-31
Family gamma-carbonic anhydrase-like 0.023
Further Details:      
 
Domain Number 3 Region: 636-742
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.71e-17
Family Phosphoglucomutase, first 3 domains 0.014
Further Details:      
 
Domain Number 4 Region: 371-557
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.0000000000253
Family Phosphoglucomutase, first 3 domains 0.0052
Further Details:      
 
Domain Number 5 Region: 752-830
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.0000000000942
Family Phosphoglucomutase, C-terminal domain 0.01
Further Details:      
 
Domain Number 6 Region: 531-631
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.000000000275
Family Phosphoglucomutase, first 3 domains 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113476724|ref|YP_722785.1|
Sequence length 843
Comment nucleotidyl transferase [Trichodesmium erythraeum IMS101]
Sequence
MRGVLMAGGSGTRLRPLTCDLPKPMVPILNRPIAEHIINLLKKHQIREIIATLHYLPDVM
REYFQDGSKFGVQMTYSVEEEQPLGTAGCVKNIAELLDGTFLVISGDTITDFDLSAAIEF
HQKHKSKATLVLTRVNNPIEFGVVITDEEQRIKRFLEKPSTSEVFSDTVNTGTYILEPEI
LDYLPSNQECDFSKELFPLLLDKNEPIYGYIAEGYWCDVGHLDSYRKAQYDALQHTVKLE
LPYKERSPNLWIGENTYIDPTAKIETPTLIGDNCRIGPRVHIELGSVIGDNVTIGADANV
KRPIVWNGTLVGEDTNLRGCVICRGSRIHRRAQILEGAVVGSLSTVGEEAQISPHVRVWP
SKTVESGAILNINLIWGTTAQRNLFGQRGVQGLANIDITPDFAVKLGAAYGSTLKNGSTV
SVSRDQRNISRMVSRSLIAGLMSVGINVINLQSTAIPIARTILPTMNLVGGLHVRLSPDR
SDQILIEIFDYQGINISKVKEKNIEGAYFKEDFRRVQISEIGNMIDRHEVLNAYSKGFEN
LLNSEAIRYSKSKVVIDYCYGVSGAVLPQLLTKFGCDAVVLNASLKETSLGIEERENLLD
QLGRVVEALQANVGVQVTANGEQLILVDEVGSAIRGETLTALMVNLMLTAHPRGTVVVPI
NASAAVEQIAHRHDSHVIRTKANPTALMKACQINHNVVLGGSGDMGFIFPKLHPGFDAMF
CIAKVIEMLTIQERSLGQITADIPPITHRCYTIRCPWKVKGALMRYLVETNPPEKLELTD
GVKIINHQDNYWVLVLPDAGKPLVHIYADSNDRDWVDKTLRDYRNMIHDFVNLFMTRNQL
DNL
Download sequence
Identical sequences Q10ZL2
203124.Tery_3188 WP_011612657.1.43450 gi|113476724|ref|YP_722785.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]