SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113476777|ref|YP_722838.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476777|ref|YP_722838.1|
Domain Number 1 Region: 19-242
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.07e-57
Family PP-loop ATPase 0.00018
Further Details:      
 
Domain Number 2 Region: 223-341
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 7.32e-17
Family MesJ substrate recognition domain-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113476777|ref|YP_722838.1|
Sequence length 344
Comment tRNA(Ile)-lysidine synthetase [Trichodesmium erythraeum IMS101]
Sequence
MPYHKSSHQNWTPLHAQLHQTLRQRKLLPKNQRILIAVSGGQDSLCLTKLLLDLQSKWGW
YLAVAHCDHKWRSDSEANANYVKKIAINWQLPSYVETADKIYKSEAEARKWRYQVLSKIA
LEFNFQYIVTGHTASDRAETLLYNLIRGSGTEGLQALTWQRPLIENFLPLLVRPLLEITR
TQTSNFCQEQKIRIWEDSTNQDLHYARNRIRLELFPILRQFNPQVELALAKTAEILSAEV
KYFENETEQLLERVTKIDTNNFNLSQFESQPVKYFINRLVLLQVPLALQRRVMRHILQKV
LPVNPNFSHIEKLTTLVNAPNHSQTDPFPGGAIAKVKHPWIILV
Download sequence
Identical sequences Q10ZF9
gi|113476777|ref|YP_722838.1| 203124.Tery_3251 WP_011612710.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]