SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113476819|ref|YP_722880.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476819|ref|YP_722880.1|
Domain Number 1 Region: 34-286
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 3.14e-21
Family DNA repair protein MutS, domain III 0.02
Further Details:      
 
Domain Number 2 Region: 303-413
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.5e-17
Family ABC transporter ATPase domain-like 0.0026
Further Details:      
 
Domain Number 3 Region: 467-572
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.08e-16
Family ABC transporter ATPase domain-like 0.0036
Further Details:      
 
Domain Number 4 Region: 782-856
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000183
Family Smr domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113476819|ref|YP_722880.1|
Sequence length 857
Comment recombination and DNA strand exchange inhibitor protein [Trichodesmium erythraeum IMS101]
Sequence
MIQSETLELLEWPRLCQHLATFTGTKLGAVTASHLSIPLTRTETIHLLAQTQEVYKLETL
LVQGLSFDGIEDISGSLKRSELGGILSGYELLAIATTLAGVRKLRRAIDSYESEYELSVL
PELVADMRTYPELEQEIHRCIDDRGDVTDRASPKLAGIREKIHRLRDRIDNILRGILQRK
ANAIQQPIITQRDDRFVIPVKAPQKDAVPGIVHDTSTTGSTLYIEPNAVVNLNNQMRQLQ
RQAQREEEAIRQALTQKVAEVKEDLDQLLAITTIIDLATARARYSLWLEATPPQFTDLDS
EQPMTMGQLRHPLLVWQQQYEQKNSVVPIDVKVRPPVRVVAITGPNTGGKTVTLKTLGLA
ALMAKVGLFIPANDPVKLPWFEQILADIGDEQSLEQSLSTFSGHIRRIIRILEAIDVSKA
NIISQKLKVKTQNSKVIDSDDFSENENNSEIDNLSGNENLESSNLSSTLVLLDEVGAGTD
PTEGSALAISLLQYLADNALLTVATTHFGELKALKYEDERFENASVEFDSNSLQPTYRLL
WGIPGRSNAMTIAGRLGLKQDIIDRAQDYVGDSSEDVNQVIAGLEEQRQKQETKAKEASA
LLQETESLHQEVARKASALKERERELKLAQEVAVQEKIAEAKAEIARVIRNLQQGPLTAR
NAQKATNAINEISEKYLPSATPPPKKPGFMPKEGDRIRIPKIGQIAEVLSAPNENDELTV
KFGVMKMTVNLREVESLDGERVESFKKNKNLESQRSKKVESKSKETPPKVSSNGLAVRTS
QNSIDIRGSRVADAQFEVDRALSKAIEYGLLWIIHGKGTGKLRQGIHEFLQEHPLVERYE
LAARNDGGSGVTIAHLK
Download sequence
Identical sequences Q10ZB7
203124.Tery_3301 WP_011612752.1.43450 gi|113476819|ref|YP_722880.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]