SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113476830|ref|YP_722891.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476830|ref|YP_722891.1|
Domain Number 1 Region: 11-151
Classification Level Classification E-value
Superfamily TPR-like 1.9e-40
Family Tetratricopeptide repeat (TPR) 0.0021
Further Details:      
 
Domain Number 2 Region: 996-1220
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 5.23e-39
Family Protein prenylyltransferase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113476830|ref|YP_722891.1|
Sequence length 1240
Comment hypothetical protein Tery_3314 [Trichodesmium erythraeum IMS101]
Sequence
MENTKTNIEDNDIIAIYERAIANYQLANYQDAIADYSRVIEIKSSNAELYYSRGVAKHQM
EDYQGAISDYTEAIKIDPNNSSVYNNRGIALSQIGRYQDALTDVTEALRLNPNDADSYYN
RGFVYEATSDYEKAIADYTQALTINPSYNLANKRREYITTLIKPQSESSANETLTQTPQT
NVEEEKPPKVALEENLTQTSQTNIEMQKSSGIESDVEEEKPSKVALEETLIQTSQTNIEM
EKSQEIESDVEKQQQSPEALKTSENSAPNFLKRWLNPYLRKGTSVDETLPTTTQTDVETE
KSSEIQTDVETEKSSEIQTDVETEKSSELSVDETLATTTQTDVETEKSSETQTDVETEKS
SELSVDETLATTTQTDVETEKSSEVSVDETLATTTQTDVETEKSSEVSVDETLATTTQTD
VETEKSSEVSVDETLATTTQTNVETERSSETQPLLKRLLNRYLRRGIPVDETLATTTQTD
VETKKSQEVSVDETLATTTQTDVEAEKSPEIQADVDSQTSSEVSVDENLKTQTQTDVEAE
KSPEIQADVDSQTSSEVPVDENLKTQTQTDVESEKSPEIQADVDSQTSSEVPVDENLEAQ
TQTDVESEKSPEIQADVDSQTSSEVSVDENLETQTQTDVESEKSPEIQADVDSQTSSEVP
VDENLKTQTQTDVEAEKSPEIQADVDSQTSSEVSVDENLETQTQTDVEAEKSPEIQADVD
SQTSSEVSVDENLETQTQTDVEAEKSPEIQADVDSQTSSEVSVDENLETQTQTDVEAEKS
PEIQADVDSQTSSEVPVDENLETQTQTDVEAEKSPEIQADVDSQTSSEVPVDENLKTPTQ
TDVESEKSPEIQADVDSQTSSEVPVDENLKTPTQTDVESEKSPEIQADVDSQTSSEVPVD
ENLKTQTQTDVESEKSPEIQADVDSQTSSEVSVDENLETQTQTDVESEKSPEIQADVDSQ
TSSEVPVDENLAINTQGKITDFKHSNADYQQEKTLSQKDTQETIQSLTEELQLHPNQAHI
YYQRGEIFFQHKNYQEAKADFTEALQLNPDEAIYFNKRGIARSCLEDYQGGLDDFTAAIT
INPTNLDACSNRGYLYYSVIKDYKLAIEDFTTVIQANPKDVDAYNYRGICLYEIQEFYGA
IADFTEAIKINPKDANTYYHRAISNYKIGDNQQAIDDCTEAIKLEPTDARYYRNRAMLRY
DTEDNQGGLDDLQKAADIYQKQGQNDDYQEVIKMMRKLKK
Download sequence
Identical sequences Q10ZA6
WP_011612763.1.43450 gi|113476830|ref|YP_722891.1| 203124.Tery_3314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]