SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113476840|ref|YP_722901.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476840|ref|YP_722901.1|
Domain Number 1 Region: 257-509
Classification Level Classification E-value
Superfamily HemD-like 3.14e-70
Family HemD-like 0.0044
Further Details:      
 
Domain Number 2 Region: 2-234
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 2.09e-60
Family Tetrapyrrole methylase 0.00000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113476840|ref|YP_722901.1|
Sequence length 512
Comment uroporphyrinogen-III synthase / uroporphyrinogen-III C-methyltransferase [Trichodesmium erythraeum IMS101]
Sequence
MKVYIIGAGPGNKEYLTLKAHALITQGEVLIYDALIDDSILELAPENCLKIEMGKRGGKP
SISQSEINSLLIEKYNLGKQVIRLKGGDPFIFGRATPEIQALIKAGCEFEIVPGISSTLA
APLLANIPLTDTVMSRAFVILTAHDIKVLDWETISKIETLVILMGAKNLGEIVHQLLKHQ
RKPQTPVAIIKNCATPKQQIWISNLSNIAKQTYAEYLSPCVIIVGEVVRLRDYLQYPNNM
VREKSEAKTEIAPLANKTILVTRSAGQSSKFSELLKKQGAKVIEMPALVITPPSSWHDLD
LGITNINSFDWLILTSTNGVDYFFERLAEKGKDSRALAGVKIAVVGKKTAESLKTCGLVP
DFIPPNFVADSLVANFPEKLSGKKILFPRVETGGREVLVKELNSQGAEVIEVAAYESSCP
ENILPEALLALQNYHIDVITFASSKTVKNFCYLIGENKDKLPEDLLENICIASIGPQTSQ
SCHSLLGRVDVEAQEYTLDGLTKAIIEWVRVA
Download sequence
Identical sequences Q10Z96
gi|113476840|ref|YP_722901.1| 203124.Tery_3325 WP_011612773.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]