SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113476850|ref|YP_722911.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476850|ref|YP_722911.1|
Domain Number 1 Region: 132-237
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.61e-16
Family FHA domain 0.0045
Further Details:      
 
Weak hits

Sequence:  gi|113476850|ref|YP_722911.1|
Domain Number - Region: 3-26
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0683
Family Rubredoxin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113476850|ref|YP_722911.1|
Sequence length 239
Comment FHA domain-containing protein [Trichodesmium erythraeum IMS101]
Sequence
MYITCETCGYDNNPTDAEYCEACGAELKSTSPAIIEQNQPITTPKVIPMTPSGPELAVTT
CQACGYDNNPIDAEYCGACGAELKSIAATTIQTNPTITTPKFIPITPSGPGLESTSAIPT
PSLSTTISPARLVAKQPNVPQSEFPLNNVAVVGVFDPDSGPVDIDLESFLGGETVSRQHA
EIYPEYGHWMVKDLGSLNGIFIKPSGQTRFGARITTPMNLNPGDEIAFGKVQFVFRLGS
Download sequence
Identical sequences Q10Z86
gi|113476850|ref|YP_722911.1| 203124.Tery_3335 WP_011612783.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]