SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113476895|ref|YP_722956.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476895|ref|YP_722956.1|
Domain Number 1 Region: 149-251
Classification Level Classification E-value
Superfamily Cell-division inhibitor MinC, C-terminal domain 2.62e-29
Family Cell-division inhibitor MinC, C-terminal domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113476895|ref|YP_722956.1|
Sequence length 259
Comment septum formation inhibitor [Trichodesmium erythraeum IMS101]
Sequence
MSDTSVSTTSTSTKEVSTNLQVRFKTEKGKLLLLFPPESNHGDIESPIPMTWTEIWQQLK
QRLKAGEKFWQPQTEVELIAFDRLLDTRQLQEIAEALLEVKLNLKRVSTSRRQTAVAAAT
VGYSVEQKSTLNTLNKTSTKKVQPLAEPLYLEMTVRSGVEIRHPGTIIIIGDLNPGGYVI
ADGDILIWGRLRGVVHAGAQGNSKSVIMTLQMEPTLLRIADKVARGPEKVPVQFYPEVAY
VLNQGIRISRAKDFAKIYR
Download sequence
Identical sequences Q10Z41
203124.Tery_3382 WP_011612828.1.43450 gi|113476895|ref|YP_722956.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]