SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113476926|ref|YP_722987.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476926|ref|YP_722987.1|
Domain Number 1 Region: 279-424
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 8.44e-37
Family Pentapeptide repeats 0.00025
Further Details:      
 
Domain Number 2 Region: 132-260
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.57e-34
Family Pentapeptide repeats 0.00067
Further Details:      
 
Domain Number 3 Region: 36-162
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 9.29e-31
Family Pentapeptide repeats 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113476926|ref|YP_722987.1|
Sequence length 448
Comment pentapeptide repeat-containing protein [Trichodesmium erythraeum IMS101]
Sequence
MANQKSLDKLQKLIKDTINQAINNGDQASHQKLTNNFAGVNLESVDLSMSDLDDVNLSET
ILRGAYLLCANLKRTNFSNSDLSGANLSGAIMWFANFSKVNFKGADIRGASFKSANLKGA
DLEGANLWRSEITDAYLIQANLLYANLIRANLRNSNLTNVNLSYAELNDANLNEANLIGT
NFSYANLSNATLKDANLKDSNLSNVNLVGTQLNGANLEGANLEGANLIGTNFSDANLNYT
KLRNTNLNHVNLRGVKINHGTELDNKWYLVWDIINHGAYGRNLSGVHLENADLKGANIGT
ANLTNANLEYANLRYANLSNANLAHIKLTNANLADINLIKANLYSANMQGANLSNTLLFN
SIMTGALLNQAKLLKAQLCDAELSNAKLIMANLMNANLKNARLLGADLRKINLEGAELDG
AIFGNNMGVSEKMKQDLIKRGAVFKDKF
Download sequence
Identical sequences Q10Z10
gi|113476926|ref|YP_722987.1| 203124.Tery_3417 WP_011612858.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]