SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113476935|ref|YP_722996.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476935|ref|YP_722996.1|
Domain Number 1 Region: 138-477,506-581
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2e-132
Family Amylase, catalytic domain 0.000000092
Further Details:      
 
Domain Number 2 Region: 7-151
Classification Level Classification E-value
Superfamily E set domains 3.64e-49
Family E-set domains of sugar-utilizing enzymes 0.0016
Further Details:      
 
Domain Number 3 Region: 595-705
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 3.38e-22
Family alpha-Amylases, C-terminal beta-sheet domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113476935|ref|YP_722996.1|
Sequence length 707
Comment glycogen debranching protein GlgX [Trichodesmium erythraeum IMS101]
Sequence
MYVPLWPGKPYPLGSSWNGKGTNFAIFSENATSVELCLFDKQNKETRLTLTEVSNFIWHG
YLPGISPGQKYGFRVHGPYEPSQGHRFNPNKLLIDPYAKAIDGNILYGQEIFAYSWDNPE
KDLVCILDDDAHLMPKSVVIDESFDWGDDKLLNIPNHESVIYEINLKGFTKLHPEIPENL
RGTYAGLAHPTAIAYLQSLGITAVELMPIHHFLRYPGHLVDKELSNYWGYDSINYFAPYS
GYSSSSKAGGQVREFKQMVKALHNGGIEVILDVVYNHTGEGNHLGPTLSFKGIDNAAYYR
LVEDDPRYYMDFTGCGNSLNVRHPQILKLIMDSLRYWVTEMHVDGFRFDLASALARELYE
VDSLAAFFDIVHQDPVISNVKLIAEPWDVGEGGYQVGNFPLLWSEWNGKYRDTVRDFWRG
EKETLAEFAYRFTGSSDLYASNGRLPHASINFVTAHDGFTLNDLVSYNEKHNEANGEDNN
DGEKHNRSWNSGEEGETNDPEILSLRNRQRRNFLVTLMLSQGVPMLLGGDEFGRTQKGNN
NAYCQDNEISWVNWNLQVENLDLLDFTRELIYFRFQHPVFYRRKWFQGRAIHGSDVSDIG
WYNPDGGEMTEEQWNIDFAKAVGIFLNGEEIPASGRRGERIIDDSFMIFFNAHYELIEFT
IPPRFQDRNWVIIIDTSKSAFVENGKYYKGKILVPVMEHSIVVLQLL
Download sequence
Identical sequences Q10Z01
WP_011612866.1.43450 gi|113476935|ref|YP_722996.1| 203124.Tery_3430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]