SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113476998|ref|YP_723059.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|113476998|ref|YP_723059.1|
Domain Number - Region: 28-154
Classification Level Classification E-value
Superfamily Undecaprenyl diphosphate synthase 0.0366
Family Undecaprenyl diphosphate synthase 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113476998|ref|YP_723059.1|
Sequence length 211
Comment hypothetical protein Tery_3496 [Trichodesmium erythraeum IMS101]
Sequence
MAENHLSLENRDYTFIFARSHESWSFSHPHYEHWLAAQTKIINLAKFCQSLDNSGITVYL
ASKPFVKETNTEVITLARLFQIKNPPKRMDLVTSLEDAINDYFQRRDAKKTQNGDIILVL
VDKISHEQKALINLIINATKKINFIPGTQKSYELGISFLQVGEDQVTKEHLNYLDDRLVQ
VGAKCDIVDTKLWYKIKEKFMTNILVSALVD
Download sequence
Identical sequences Q10YT8
WP_011612928.1.43450 203124.Tery_3496 gi|113476998|ref|YP_723059.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]