SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113477025|ref|YP_723086.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477025|ref|YP_723086.1|
Domain Number 1 Region: 569-800
Classification Level Classification E-value
Superfamily C-type lectin-like 4.5e-74
Family Sulfatase-modifying factor-like 0.00029
Further Details:      
 
Weak hits

Sequence:  gi|113477025|ref|YP_723086.1|
Domain Number - Region: 58-150
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.046
Family BAR domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113477025|ref|YP_723086.1|
Sequence length 802
Comment hypothetical protein Tery_3524 [Trichodesmium erythraeum IMS101]
Sequence
MAVPLLPFVTTTGAAVWNSCVNAFNLAFGRTMPKNLEGQQLAHQKELQEKQIVAQFEIKY
MRTISQIKLQHNHPEFQQRLEVARKEFQAKIAEYQYQKNRQLQDFIKIVNMQIANSNKEF
KTWLFKQQKKVQIELSQYNRETQYLNAAYQREIALEIKELENWPLKNYPWQILQYHQDRN
PIPIQIILAPPEVNYDRFQSINSTSKPEFPQVEKRLSQYLKNFLQKYYPVENQQRPTELI
DHAWESNRFAGGSAVKTIFSRLKSEPIVLIESEVDGGFINIQLAYWSGGQEVSPFYKTII
SHLHYPKIIYAFAIQRALHWEANVKQKLLAQGVNEQEIDQEYGGDNLLNLQIYRKYEQDK
LAGIEFERQYKTNQEDFDKLSALLGAYHNIIVALFTDIHYLIHTNLSPKLPELLAELETE
FSVDKRLGEDLFKMVVESYIGSLRAMEQDRSELVPEFAVDIALGLARLSNPIWAEQMLDF
ALESWLNSRYLFPKNGKEKFDLVTENLLPLDQEFMTKVNRCMVDLAEDKKESLSDNVTNS
ITEVPILEIPPKALELPSQKIEDLGNGIELEMIYVPGGSFLMGSPKDEEARNSNESPQHE
VILQAFYMSKYPITQNQYQAIMGNNPSSFEGESRPVEYVNWYDATEFCQKLSSKTGDVYV
LPSESQWEYACRAGTVTPFYFQDTITSELVNYNANHPYGDAPKGEYRQETTDVGIFPPNA
FGLYDMHGNISEWCQDVWHNSYKGAPIDGSAWESGRSNSYRLLRGGNWSDGSRYCRSAGR
VYAHADIRSNGKGFRIILSLKS
Download sequence
Identical sequences Q10YR1
WP_011612955.1.43450 gi|113477025|ref|YP_723086.1| 203124.Tery_3524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]