SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113477043|ref|YP_723104.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477043|ref|YP_723104.1|
Domain Number 1 Region: 143-361
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.1e-52
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000901
Further Details:      
 
Domain Number 2 Region: 446-587
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.22e-36
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000579
Further Details:      
 
Domain Number 3 Region: 12-142
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.09e-28
Family Duplicated SiR/NiR-like domains 1 and 3 0.0047
Further Details:      
 
Domain Number 4 Region: 363-439
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.36e-18
Family Duplicated SiR/NiR-like domains 1 and 3 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113477043|ref|YP_723104.1|
Sequence length 902
Comment sulfite reductase subunit beta [Trichodesmium erythraeum IMS101]
Sequence
MIIPSQISTPKEAKPSKLEGIKENSNLLREPLASQLLEDTNHFTEEAVQILKFHGSYQQH
NRDNRIKGQEKDYQMMLRTRNPGGFIPPQLFLTLNKLSNEYGNGTLRVTTRQGFQLHGVL
KKNLKKVISSIIKSMGSTLGACGDINRNVMSPPAPYKNRPEYEYAKDYANKIADLLTPQT
GAYYEIWLDGEKVISAQEASEVKVARLRNGNGTIFPNSEEPIYGTHYMPRKFKCAVTVPG
DNSIDLYTQDVSLVVITNEVGELEGFNVLAGGGLGRTHRKEETFPCLAQEIGYVTKEDIF
DFMKAIVATQRDYGDRSNRRHARMKYLLHDWGVEKFKAKLIEYFGKSIAPFKPLPEWKYL
DFLGWHEQGDGRLFLGISVENGRVKDEDSFQLKTALRKIVDLFKLPMLLTANHNIILYEI
KPQQQQAVEQILNKHGISTEKNIDPLVRYSMACPALPTCGLAITESERTLPGILGQIRLL
LDKVGLGQEHFVVRMTGCPNGCARPYMAELGFVGSAADSYQIWLGGSPNQTRLAKPYIDK
LHINNLEAELERIFIYFKQQRQPDESFGDFCNRVGIEAIRKFVTNYQSSFSMNTDINNSS
LTSINSEKNIPIVTDVTETTPDTKSQEESTSKNLENNQEVIPMNSPVTQSTNMTQTTTTS
TTISEAQPLSTHQTPKTPTFSSDTNTTISTPSTLGKQEGQPTVETTPSTSVQQEDKLTVE
TTSGQQEGQTTVEPTIPSTSGQQEGQTTVEPTIPSTSGQQEGQPTGEPTIPSTLGKQEGQ
PTVETTIPNLDKQEAQPNRESTISDNLDKQEAQPTSESTISANLDQQEAQPIGQLESSPD
KPKDTSKMRHRVSVRDEIYTKLKEESKRQGKPVVQLATEAIAEYLEKIRKNESLTTTNET
NF
Download sequence
Identical sequences Q10YP3
gi|113477043|ref|YP_723104.1| WP_011612972.1.43450 203124.Tery_3544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]