SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113477219|ref|YP_723280.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477219|ref|YP_723280.1|
Domain Number 1 Region: 408-605
Classification Level Classification E-value
Superfamily FtsH protease domain-like 4.71e-73
Family FtsH protease domain-like 0.00000258
Further Details:      
 
Domain Number 2 Region: 154-421
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.08e-71
Family Extended AAA-ATPase domain 0.0000000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113477219|ref|YP_723280.1|
Sequence length 613
Comment FtsH peptidase [Trichodesmium erythraeum IMS101]
Sequence
MNNKKWRNAGLYALLAIVVIALATAFFDQQPQARETWKYSQFIQQVENKNVEKVDISADR
TVARVKVADGSVVRVNLPNDPDLINILTQNNIDISVLPQNEEGFWVRALSSLFFPILLLV
GLFFLLRRAQSGPGSQAMNFGKSKARVQMEPQTQVTFSDVAGIEQAKLELTEVVDFLKNA
DRFTAIGAKIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSEFVEMFVGVGASRVR
DLFEQAKSSAPCIVFIDEIDAVGRQRGAGLGGGNDEREQTLNQLLTEMDGFEGNTGIIII
AATNRPDVLDAALLRPGRFDRQVVVDRPDYAGRLEILNVHARGKSLSKDVDLEKIARRTP
GFTGADLSNLLNEGAILAARRNLTEISMDEVNDSIDRVLAGPEKKDRVMSEKRKELVAYH
EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRAYLQNQMAVALG
GRLAEEIVFGDEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQNGNMFLGRDI
MSERDFSEETAAAIDDEVSNLVDQAYRRAKEVLVGNRHILDRLAEMLVDKETVDSDELQE
LLATNDVKMAALI
Download sequence
Identical sequences Q10Y67
gi|113477219|ref|YP_723280.1| 203124.Tery_3755 WP_011613138.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]