SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113477235|ref|YP_723296.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477235|ref|YP_723296.1|
Domain Number 1 Region: 39-131
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 3.27e-29
Family Pentapeptide repeats 0.0012
Further Details:      
 
Domain Number 2 Region: 138-204
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000617
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113477235|ref|YP_723296.1|
Sequence length 255
Comment pentapeptide repeat-containing protein [Trichodesmium erythraeum IMS101]
Sequence
MRVKIFSAVLVFTTVFPNLTAIGENIQHTQRLLSSKQCPNCELIGVGLVLANLQGANLEG
ANLSGANLSRANLTGANLSGANLAGTSLFGANLTGANLSGANLAGTDLRSAYLTGANLTD
VDLKNAFLLGVVGMPSNIGEAEDFYRLGIAEAKAGNYKDAVRYYNQAISMKSDLAAAYFA
RSMSLADLGNLNAAIADAQKSRDIFVSKGSKEGEELSQYLVEIIDLRLNPPKPEKPNQFV
HAIGSLLPALLRLAF
Download sequence
Identical sequences Q10Y51
gi|113477235|ref|YP_723296.1| 203124.Tery_3776 WP_011613153.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]