SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113477386|ref|YP_723447.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477386|ref|YP_723447.1|
Domain Number 1 Region: 149-278
Classification Level Classification E-value
Superfamily GUN4-like 1.57e-47
Family GUN4-like 0.00012
Further Details:      
 
Weak hits

Sequence:  gi|113477386|ref|YP_723447.1|
Domain Number - Region: 2-24
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00753
Family Rubredoxin 0.015
Further Details:      
 
Domain Number - Region: 91-158
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0209
Family Outer membrane efflux proteins (OEP) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113477386|ref|YP_723447.1|
Sequence length 305
Comment hypothetical protein Tery_3945 [Trichodesmium erythraeum IMS101]
Sequence
MLCPICGTEYLETVPESCSICEWNLTSESAFFATAEIYQKKEQAQLNWARKTWQMLQAKE
HSSHHNHNSGLPNVAADKINDKQNYLAIQKQLDQIQAQLHQATIERLQLHSQLEWVLYHL
EQLNSETLAQTLYRIDEKLHSIPTPEPPMSEVGINYNPLINLLAARKWRKADELTWELLL
QATLREEEGWLHLADIENFPCTDLCTINWLWEYYSDGLFGLNTQQRIWESVSGQYEDFCD
RLGWRDGENWKYYDELSFNLEAPEGHLPIIIWRRRACYGVGQMMAGETFLALRRRVTTCT
GMTTD
Download sequence
Identical sequences Q10XQ0
WP_011613304.1.43450 gi|113477386|ref|YP_723447.1| 203124.Tery_3945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]