SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113477431|ref|YP_723492.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477431|ref|YP_723492.1|
Domain Number 1 Region: 1077-1386
Classification Level Classification E-value
Superfamily TPR-like 3.3e-74
Family Tetratricopeptide repeat (TPR) 0.00026
Further Details:      
 
Domain Number 2 Region: 607-909
Classification Level Classification E-value
Superfamily TPR-like 7.21e-71
Family Tetratricopeptide repeat (TPR) 0.00047
Further Details:      
 
Domain Number 3 Region: 1321-1631
Classification Level Classification E-value
Superfamily TPR-like 1.48e-69
Family Tetratricopeptide repeat (TPR) 0.00015
Further Details:      
 
Domain Number 4 Region: 369-672
Classification Level Classification E-value
Superfamily TPR-like 3.79e-67
Family Tetratricopeptide repeat (TPR) 0.00034
Further Details:      
 
Domain Number 5 Region: 834-1081
Classification Level Classification E-value
Superfamily TPR-like 4.55e-58
Family Tetratricopeptide repeat (TPR) 0.00044
Further Details:      
 
Domain Number 6 Region: 238-415
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 5.23e-54
Family Protein prenylyltransferase 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113477431|ref|YP_723492.1|
Sequence length 1694
Comment hypothetical protein Tery_3996 [Trichodesmium erythraeum IMS101]
Sequence
MKGERIIWQEDFSLTFTEEYEALVETIRFNEGFSLLFAECSRAKGTEIMEKIRLDIPEQR
ADVLGLDKTIYHFYNRVKELPNLKEIDILFVTGLEYSFYQYEDEMKERGWDHNEIISISR
RGVPPVLINLNQQRERFRDDFDICFVFLLPRFAINYLIKRAPDFFDWRSGLFRFPMDQES
FDKGYLEVREKKLEDYIEFTKPECKVELVSIKSLLDEDLLPVGQKADLLVRKASLDRKLQ
QNEEAILTCDEALKIEPNDYNAWNNKGSALINLERYEEAVAAYEKALEIKPDFHEAWFLK
GIALINLERYEEAVAAYEKALEIKPDFHEAWFLKGIALINLERYEEAVAAYEKALEIKPD
FHEAWFLKGNALGNLERYEEAVAAYEKALEIKPDFHEAWFLKGIALGNLERYEEAVAAYE
KALEIKPDFHEAWFLKGNALGNLERYEEAVAAYEKALEIKPDFHEAWFLKGNALGNLERY
EEAVAAYEKALEIKPDFHDAWFLKGNALGNLERYEEAVAAYEKALEIKPDFHDAWFLKGN
ALGNLERYEEAVAAYEKALEIKPDFHEAWFLKGNALGNLERYEEAVAAYEKALEIKPDFH
EAWFLKGNALGNLERYEEAVAAYEKALEIKPDFHDAWFLKGNALGNLERYEEAVAAYEKA
LEIKPDFHYAWFLKGNALGNLERYEEAVAAFEKALEIKPDFHEAWNNKGIALEKLERYEE
AVAAFEKALEIKPDFHEAWNNKGIALEKLERYEEAVAAFEKALEIKPDFHEAWNNKGIAL
EKLERYEEAVAAFEKALEIKPDFHEAWNNKGIALEKLERYEEAVAAFEKALEIKPDFHDA
WFLKGNALGNLERYEEAVAAYEKALEIKPDFHEAWHNKGIALENLERYEEAVAAYEKALE
IKPDFHEAWNNKGIALEKLERYEEAVAAFEKALEIKPDFHEAWHNKGNALGNLERYEEAV
AAYEKALEIKPDFHYAWFLKGIALGKLERYEEAVAAYEKALEIKPDFHEAWFLKGIALGK
LERYEEAVAAYEKALEIKPDFHEAWHNKGIALENLERYEEAVAAYEKALEIKPDFHEAWH
NKGIALENLERYEEAVAAYEKALEIKPDYHYAWHNKGDALENLERYEEAVAAYEKALEIK
PDYHYAWNGKGIALIKLERYEEAVAAFEKALEIKPDFHDAWFLKGNALGNLERYEEAVAA
FEKALEIKPDFHEAWNNKGIALEKLERYEEAVAAFEKALEIKPDFHEAWHNKGNALIKLE
RYEEAVAAYEKALEIKPDFHDAWFLKGNALIKLERYEEAVAAYEKALEIKPDFHEAWFLK
GNALIKLERYEEAVAAYEKALEIKPDFHEAWFLKGNALIKLERYEEAVAAYEKALEIKPD
FHEAWFLKGNALGNLERYEEAVAAYEKALEIKPDFHEAWHNKGIALGKLERYEEAVAAFE
KALEIKPDFHEAWHNKGNALIKLERYEEAVAAYEKALEIKPDFHEAWFLKGNALIKLERY
EEAVAAYEKALEIKPDFHEAWFLKGNALIKLERYEEAVAAYEKALEIKPDFHEAWFLKGN
ALIKLERYEEAVAAYEKALEIKPDDEYSIINLGLVKYEMGFIDQAIENWQAATEINNQLV
EPKLAIGVALYKKGKIPESLATTEAALKSDKSWGSSKRLKKELWGDKLIADAAKLLENPQ
IKALLSQTKNSVLT
Download sequence
Identical sequences Q10XK5
WP_011613349.1.43450 gi|113477431|ref|YP_723492.1| 203124.Tery_3996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]