SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113477597|ref|YP_723658.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477597|ref|YP_723658.1|
Domain Number 1 Region: 11-69
Classification Level Classification E-value
Superfamily Lysozyme-like 0.00000000000000225
Family Phage lysozyme 0.024
Further Details:      
 
Domain Number 2 Region: 169-236
Classification Level Classification E-value
Superfamily PGBD-like 0.000000000235
Family Peptidoglycan binding domain, PGBD 0.019
Further Details:      
 
Weak hits

Sequence:  gi|113477597|ref|YP_723658.1|
Domain Number - Region: 277-394
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 0.0523
Family L,D-transpeptidase catalytic domain-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113477597|ref|YP_723658.1|
Sequence length 414
Comment peptidoglycan binding domain-containing protein [Trichodesmium erythraeum IMS101]
Sequence
MIGNGFAEFNNVGTGAFQSSTLLKKLNQGDYQGAANEFSRWVNGVVNGVKQSLPGLVSRR
ADEKRLFLKAGGEKKPLEDEISKQDKVTWLEGYRDENKKTVVVAWNGGKVEEILTLEKFN
KELLANVFPQYKNARYYVTAPGNKRIPPGERISVFEISDIYNSDKLPKLNRVLVRGSEGS
DVKILQERLKDLGYYLGELDAIFGRQTELAVIDFKKDYFGITTDNATVESITWKKLWGDP
LPKPPVLPPTSKKNYLLLTKTSRKDRYGCYVLHLDYFKSGKLEDRLEVCCGAPGRQFFRT
AARSRAMTGEPLPEGKWYINDIIWADGQDNYYGQIFQSGIGPVTVPLDYIEPGTTERSAI
EIHIDWNRNYGSPGTVGCIATYNIADYKRFITWLRDTDPRDLYVDWKLGTSPKP
Download sequence
Identical sequences Q10X39
gi|113477597|ref|YP_723658.1| 203124.Tery_4180 WP_011613515.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]