SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113477602|ref|YP_723663.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477602|ref|YP_723663.1|
Domain Number 1 Region: 30-491
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 1.24e-172
Family Type II DNA topoisomerase 0.000000000314
Further Details:      
 
Domain Number 2 Region: 503-712,755-868
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 2.35e-96
Family GyrA/ParC C-terminal domain-like 0.0000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113477602|ref|YP_723663.1|
Sequence length 885
Comment DNA gyrase subunit A [Trichodesmium erythraeum IMS101]
Sequence
MTTSESRIVPTDLRNEMSQSYLEYAMSVIVGRALPDARDGLKPVHRRILYAMHELGLTPD
RPFRKCARVVGEVLGKYHPHGDTAVYDALVRMAQDFSMRSPLIQGHGNFGSVDNDPPAAM
RYTECRLQVLTCDAMLRDIDSETVDFADNFDGSQQEPLVLPSRVPQLFLNGSSGIAVGMA
TNIPPHNLGELIDGLVALIHNSEITENELIQHIPGPDFPTGAQILGKSGIRDAYTLGRGS
ITMRGVATIETIEQRGRPDKEAIIVTELPYQTNKAALIEKIAELVNDKKIEGISDIRDES
DRNGMRIVIELKRDAYPRVVLNNLYKQTPLQANFGANVLALVNSEPQLLTLKKYLEVFLE
FRVETITRRTEYELRKAEERDHLLQGLLIALDNLDEIIQLIRNAADTPNAKKELIENYGL
SEVQSDAILQMQLRRLTALEAQKIQKEHEELLLKIADLQDILAKRERILEIIETEAIEIK
ERHATPRRTVIELAEGELDDTDLIANEKAIILLTEQGYIKRMPVNSFEAQSRATRGKSGT
KMKEDDVVEHFLSCYDHDSILFFSQRGVVYCLNAYQIPIGSRVARGVPIVQMLPIPRDEK
VTSIVAVSEFTDDKYLVMLTKGGYIKKTSLSAFANIRSNGLIAISLGEGDSLRWVRRAKV
DDSLIIGSSYGMAIHFRTDNKQLRPLGRNTRGVKSMKLIKGDELISMDILPSSIVENIAD
IDEENLELEEEELEIETDEIEEVESDEFTATNNIGSWVLVITTNGYGKRVPVSQFTLQNR
GGKGRIATKFKQKKKKQDQVAALRVVNESEELMIITAKGIIIRQAIDAISIQSRSATGVR
VQKLDDADAIAEVALVPATETEETIEIEEGIMEAEVVETEEDMEE
Download sequence
Identical sequences Q10X34
203124.Tery_4186 gi|113477602|ref|YP_723663.1| WP_011613520.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]