SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113477640|ref|YP_723701.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477640|ref|YP_723701.1|
Domain Number 1 Region: 165-351
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.97e-66
Family Methylesterase CheB, C-terminal domain 0.0000099
Further Details:      
 
Domain Number 2 Region: 1-120
Classification Level Classification E-value
Superfamily CheY-like 4.13e-32
Family CheY-related 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113477640|ref|YP_723701.1|
Sequence length 352
Comment response regulator receiver modulated CheB methylesterase [Trichodesmium erythraeum IMS101]
Sequence
MPKFRILIVDDSVIVRRIINNILSESDWIEVVGVAPSGQIALAKIPQVNPDLIILDVEMP
EIDGLETLKRIRQTYKQLPVIMFSAITQRGAIATLDALTLGANDYITKPANMGSKEKAIE
YIRKQLIPKIQVFCHRKVSLTKHCLAPSMTSFQRKTSTQLLTLKLEIVAIGVSTGGPQAL
YQLLHKFPASFRVPIVIVQHMPPVFTTRLAERLSSQCKIPVHEAKDRDVIKSGEAWIAPG
NYHIILVREGKQVRIQTIQTPPENSCRPAVDVLFRSVAKLYQGAVLGVVLTGMGQDGLHG
CTSIREMGGQVLVQDQASSVIWGMPGMVANAGLADQILPLNKLAEEIIRRIG
Download sequence
Identical sequences Q10WZ6
gi|113477640|ref|YP_723701.1| WP_011613558.1.43450 203124.Tery_4227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]