SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113477809|ref|YP_723870.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477809|ref|YP_723870.1|
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily RbcX-like 3.4e-45
Family RbcX-like 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113477809|ref|YP_723870.1|
Sequence length 128
Comment chaperonin-like RbcX [Trichodesmium erythraeum IMS101]
Sequence
MDIKKVAKDTAKVLTSYLTYQAVRTVTNQLRETNPPLGIWLSGFSSTGKIQDGEAYLQEL
LQENQELAFRVMTVRQHLAEEVADYLPEMVRSSIQKANIEHRRGYLEKITQLEIADPSLD
PEQGTDEL
Download sequence
Identical sequences Q10WH7
WP_011613723.1.43450 gi|113477809|ref|YP_723870.1| 203124.Tery_4409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]