SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113477960|ref|YP_724021.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477960|ref|YP_724021.1|
Domain Number 1 Region: 799-978
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 2.88e-24
Family Peptidoglycan hydrolase LytM 0.0029
Further Details:      
 
Domain Number 2 Region: 115-220
Classification Level Classification E-value
Superfamily Collagen-binding domain 1.83e-17
Family Collagen-binding domain 0.0026
Further Details:      
 
Domain Number 3 Region: 628-713
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000379
Family Collagen-binding domain 0.0053
Further Details:      
 
Domain Number 4 Region: 744-831
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000981
Family Collagen-binding domain 0.0085
Further Details:      
 
Weak hits

Sequence:  gi|113477960|ref|YP_724021.1|
Domain Number - Region: 441-610
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00544
Family Fibronectin type III 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113477960|ref|YP_724021.1|
Sequence length 995
Comment peptidase M23B [Trichodesmium erythraeum IMS101]
Sequence
MSDILGDFSNFEQDLSNLILIGDKQENFDDGQRWTSGIEPTGNNSKLKVEEFNTGGDEPS
QPLQGQKFFDLGELNHLSASNSPPGKKDPLVGEDNEAVVKKSDNLINPNPINRRSGNSRN
RADNIGTLSSSSSFTGFVGTTDTNDYYRFYLSGEREFNLTLNGLSGDADVRLLNSSGGTI
SSSTKGGSSSESISETLNSGTYYIRVYPMSGVNTNYNLNIEATSSSSDEEVNITSPSSRT
SIEPGERYNIRWTDNFRDNVKLELYKGSSRQQTIARSTSSDGSYSWRAPTSLSSGTNYRI
KIRNVNDSSVYDYSSYFTIEPDEPDGVVNITSPSSSTSIEPGERYNIRWTDNFRDNVKLE
LYKGSSRQQTIARSTSSDGSYSWRAPTSLSSGTNYRIKIRNVNDSSVYDYSSYFTIEPDE
PDEKVNITSPSSSTSIEPGERYNIRWTDNFRDNVKLELYKGSSRQRTIARSTSSDGSYSW
RAPTSLSSGTNYRIKIRNVNDSSVYDYSSYFTIKPDEEVNITSPSSSTSIEPGESYTIRW
TDNFSDNVKLDLYKGSSWQQTIASSTSSDGSYSWRVPTSLSSGTNYNIKIRNVNDSSVDD
YSNSFTIQSTTWPPSVTKDLKTYTGREEYSGYVGNDDYYKFSVDSPGYLQFALRGMSADA
NLQLLNSSGKVLESSSKSGNSDEYANENLGIGTYYMRVYGHNGADTNYRLVLNLDKAKND
RSNARWLGELAGQRKEYKDFIGTSSGDQYDYYKFTVQEPRFLEYALRDLTAPADIDILNS
SGARITPKENDKDNHRYNLHETMGLQAGTYYARVTAPTDSSQQTNYKLVLNLKGEYKPLH
SNPTESNPLKGFQSPVRGERWYVSQSPGGSYSHTGNLRYAIDISIPGWDDFGEPIYAMRS
GTVKKVVDDHPDIADSKRNNLVEIQHENGYVARYWHLQQYSNSDAGLQVGQKVDAGQMIG
RVGNSGFSTGPHLHVDVVDSSLITRPFEIEGIFDY
Download sequence
Identical sequences Q10W26
WP_011613865.1.43450 gi|113477960|ref|YP_724021.1| 203124.Tery_4572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]