SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113477987|ref|YP_724048.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477987|ref|YP_724048.1|
Domain Number 1 Region: 174-433
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.01e-83
Family Creatinase/aminopeptidase 0.000000247
Further Details:      
 
Domain Number 2 Region: 5-173
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 3.45e-51
Family Creatinase/prolidase N-terminal domain 0.0000701
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113477987|ref|YP_724048.1|
Sequence length 436
Comment aminopeptidase P [Trichodesmium erythraeum IMS101]
Sequence
MAISTEYKQRRKQLITKIGNGTAIFRSAPMAVMHNDVEYAYRQDSDFFYLTGFNEPEAVA
VIAPHHEKHKFVLFVQPKDQLKETWTGYRAGVEVAKEKYGADAAFSINELNKKLPEYLKK
ADKIYYRLGRDRNFNETVFKHWQNLMRVYPKSGTGPIAIQDAGTILHPMRLVKSAKELEQ
MQKAADIAVNAHNYALKFAQAGQFEYQIQAEMEYIFSRHGATPAYPSIVASGANSCILHY
IENNRQMQENDLLLIDAGAAYNYYNSDITRTFPISGKFTPEQKIIYELVLRAQLAAIEQV
KPGNPYKQIHETAVRVLVEGLIDLGMLKGNIDEIIEKEKYRPFYMHKTGHWLGLDVHDVG
VYQWGEEPQILQPGQVLTVEPGIYIGLNIKPAEGQPEIYDRWRGIGVRIEDDVLVTAEGC
EVLTAGVPKLVEDLES
Download sequence
Identical sequences Q10VZ9
203124.Tery_4599 WP_011613892.1.43450 gi|113477987|ref|YP_724048.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]