SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113478036|ref|YP_724097.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113478036|ref|YP_724097.1|
Domain Number 1 Region: 3-238
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.41e-79
Family SAICAR synthase 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113478036|ref|YP_724097.1|
Sequence length 242
Comment phosphoribosylaminoimidazole-succinocarboxamide synthase [Trichodesmium erythraeum IMS101]
Sequence
MSSHQKLYEGKAKILYTTDDPEILLTYFKDDATAFNAQKKGTITGKGKINCTISSHIFKL
LETNEIPTHFIDCPASDKMRVRRVKILPIEVIVRNIAAGSLCRQTLLTEGTILKFPLVEY
CYKNDTLQDPLLTRDRLLILELATPEQLEQIRTFAVKINDILINFFNQCQITLVDFKIEF
GLDKHENLILADEISPDSCRLWDQYQTDPNQRVMDKDRFRRDLGKVETGYQQVLERILAH
QG
Download sequence
Identical sequences Q10VV0
WP_011613941.1.43450 203124.Tery_4655 gi|113478036|ref|YP_724097.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]