SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113478040|ref|YP_724101.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113478040|ref|YP_724101.1|
Domain Number 1 Region: 7-269
Classification Level Classification E-value
Superfamily Pentein 1.63e-49
Family Dimethylarginine dimethylaminohydrolase DDAH 0.023
Further Details:      
 
Weak hits

Sequence:  gi|113478040|ref|YP_724101.1|
Domain Number - Region: 619-697
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.00147
Family Pyruvate oxidase and decarboxylase, middle domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113478040|ref|YP_724101.1|
Sequence length 703
Comment hypothetical protein Tery_4659 [Trichodesmium erythraeum IMS101]
Sequence
MNDSIRFLLCAPDHYDVDYVINPWMEGNIHKSSRDRSVEQWYKLHDIIKEHAIVDLVTPQ
KGWPDMVFTANAGLVLGKTVVLSRFYHKERQGEEPHFKEWFLSQGFIVHELPKDLPFEGA
GDALLDREGRYLWAGYGFRSELDSHPLLAKWLDIEVLSLRLIDERFYHLDTCFCPLTGGY
LLYYPPAFDSYSNRLIEMRVPPEKRIIVAEADAVNFACNAVNINQTIIMNKVSDDLKSGI
TEAGFKIIETPLTEFLKAGGAAKCLTLRVTEPIIPDSYASVQVESRTIRMEGHLLDAGLI
NQALDLIVEGGGSFKVLNFNLGEQRQSTSLAEVKVSAPSHGIMEEIMSQLIDIGAVIPTE
NVQDAKLEPVEQDGVAPDDFYVTTIYPTEVRVKGQWIQVQNQRMDGAIAITEADGHIQAK
CKVIRDLKIDEKAVVDVAGIRTIRKTESREKRNKEEFSFMSAGVSSERRVELVVEQVAWE
LRQIRDRGGKVVVTAGPVVIHTGGSKHLASLIRQGYVQALLGGNAIAVHDIEQSLMGTSL
GVDMTQGVAVHGGHRHHLNTINTIRRCGSIATAVEKGVLTNGVMYECVKNNVPFVLAGSI
RDDGPLPDTQMDLIKAQEEYTELLKGVDMVLMLSTMLHSIGVGNMTPAGVKMVCVDINPA
VVTKLSDRGSVESIGVVTDVGLFLSLLITQLDQLTSPYFVGKV
Download sequence
Identical sequences Q10VU6
gi|113478040|ref|YP_724101.1| 203124.Tery_4659 WP_011613945.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]