SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113478176|ref|YP_724237.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113478176|ref|YP_724237.1|
Domain Number 1 Region: 7-136
Classification Level Classification E-value
Superfamily CheY-like 1.11e-29
Family CheY-related 0.0019
Further Details:      
 
Domain Number 2 Region: 142-308
Classification Level Classification E-value
Superfamily GAF domain-like 1.53e-21
Family GAF domain 0.0051
Further Details:      
 
Domain Number 3 Region: 329-493
Classification Level Classification E-value
Superfamily PP2C-like 0.000000549
Family PP2C-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113478176|ref|YP_724237.1|
Sequence length 553
Comment response regulator receiver modulated serine phosphatase with GAF sensor [Trichodesmium erythraeum IMS101]
Sequence
MSLGDRKLKLLVVDDEPDNLDLLYRTFRRDFKVYKADSAFTAMDVLKAEGEMALIISDQR
MPEMNGTEFLGRTFEIFPDTVRILLTGYTDVEDLVEAINSGKVFKYITKPWTPEELKLVV
QQASETYKVLKQRTKTLTLALRRESILNEVMSVIRESLDYSDMLSTIVKTVGQTFTATEG
ILWPVAGDRLISKPVSYQSSENTEKNFPITEELLLQVVKSRQTYFEEGSNKNSCKLIVPL
IYQQDLLAVLALNQQNSSNFWSDEDIKFIESVLEQGALALSQAKLYQRTRELAEQMRNEL
EVARQIQSNLLRQSWPDFDKFRIQACCYPAREVGGDFFEVYTHPQGEIWLALGDVSGKGV
PAALFMASAISLMRRELSQENSPEPYEVMHNLNSSLSDDLISSNCFITMVLARYTPENGS
LAYANAGHIYPLVWSKNPLVNTGNKGSEQVPNFLKDRGIPLGILPIWRGKAGTIELDSGD
VFLLTSDGITEATVVQKATDSGEVSRVMLQQEGLWKLLKEHKSQLDLNSLLAYIRTDNQV
QEDDQTILSLEVL
Download sequence
Identical sequences Q10VG0
gi|113478176|ref|YP_724237.1| 203124.Tery_4817 WP_011614078.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]