SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113478239|ref|YP_724300.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113478239|ref|YP_724300.1|
Domain Number 1 Region: 3-219
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.09e-68
Family "Hypothetical" protein ybl036c 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113478239|ref|YP_724300.1|
Sequence length 226
Comment hypothetical protein Tery_4903 [Trichodesmium erythraeum IMS101]
Sequence
MVESIAERITNIKSNLPKSVRLIAVTKQVSVDTIRTAYAAGIRDFGENKVQEAEAKQAQL
QDLPDITWHLIGHLQSNKVVKALKQFQWIHSVDNLKLAKRLNALAEQFCYSPNICLQVKI
LPDPNKYGWTITELMSDLEELNQCQHLKIKGLMTIPPQGLDDLQTLSVFQKTKELALEIR
EKNFSHLKTQELSMGMSEDYNLAISAGTTIVRLGRILFGERKNKKD
Download sequence
Identical sequences Q10V97
203124.Tery_4903 WP_011614127.1.43450 gi|113478239|ref|YP_724300.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]