SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113478333|ref|YP_724394.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113478333|ref|YP_724394.1|
Domain Number 1 Region: 4-359
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 1.44e-107
Family Dehydroquinate synthase, DHQS 0.00000425
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113478333|ref|YP_724394.1|
Sequence length 363
Comment 3-dehydroquinate synthase [Trichodesmium erythraeum IMS101]
Sequence
MASITVQLPQKSYEIAIASGHLDQLGRKMESLNLGKKVLLVSNPEIFAHYGERAIISLQE
AGFDVSDCILPSGEEYKTPQNLNCIYDAALAHRLERSSTIVALGGGVVGDMTGFAAATWL
RGLNVVQVPTSLLAMVDAAIGGKTGVNHPQGKNLIGAFHQPRLVLIDPEVLKTLPLREFR
GGMAEVIKYGVIWDAELFFQMENSQSLDDINNLTPGLLEEILIKSCQSKAHVVAKDEKES
GLRAILNYGHTIGHAVESLTGYTAVTHGEAVSIGMVAASGLALELGMWDEQSDRRQLVLI
EKASLPTKLPDGLDIDDILVSLQTDKKVKAGKVRFVLPTGIGSVTVTDKVSQDVLRRVLL
RIS
Download sequence
Identical sequences Q10V03
WP_011614215.1.43450 gi|113478333|ref|YP_724394.1| 203124.Tery_5008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]