SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113477196|ref|YP_723257.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477196|ref|YP_723257.1|
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 3.43e-18
Family Ribosomal protein L33p 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113477196|ref|YP_723257.1|
Sequence length 62
Comment 50S ribosomal protein L33 [Trichodesmium erythraeum IMS101]
Sequence
MAKGVRIIITLECTECRTNPNKRSQGVSRYTSTKNRRNTTSRLELKKFCTHCNRHTVHKE
IK
Download sequence
Identical sequences Q10Y90
WP_011613115.1.43450 203124.Tery_3728 gi|113477196|ref|YP_723257.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]