SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152978035|ref|YP_001343664.1| from Actinobacillus succinogenes 130Z

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152978035|ref|YP_001343664.1|
Domain Number 1 Region: 97-237
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.01e-29
Family Reductases 0.03
Further Details:      
 
Domain Number 2 Region: 232-339
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.24e-23
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.073
Further Details:      
 
Domain Number 3 Region: 12-106
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.25e-22
Family Ferredoxin reductase FAD-binding domain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|152978035|ref|YP_001343664.1|
Sequence length 339
Comment HCP oxidoreductase [Actinobacillus succinogenes 130Z]
Sequence
MAKTNKNPLCINELQVYSIVQEAPKVKTINFIAQDFYPYEAGQYALVSIRNTPHITRAYS
LSSTPGESRFVSITVREIDGGIGSSWLNNEVKVGDQVWFSNPMGDFSCQKIIADNYLLAG
AGSGITPIMSMTRWLLKNRPEANITVIHSVHSPEGVIFKSEWAQLKADNPGLNLVFNASV
DATDGFEHGRISKQMLAKAVPNITDYTVMTCGPQTYMNALKSMFLALGGSEQRFFTEAFF
NTALADDISSDKKTTLTVNGAKPIKTEVPVGMTLLAALEAQEQPVVSGCRTGLCGLCKTK
ITGGEYETVSTGDLTEQEIAQGYVLACSCRVKENVTVEL
Download sequence
Identical sequences A6VL82
339671.Asuc_0351 WP_011979004.1.63012 gi|152978035|ref|YP_001343664.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]