SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152978284|ref|YP_001343913.1| from Actinobacillus succinogenes 130Z

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152978284|ref|YP_001343913.1|
Domain Number 1 Region: 259-404
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.07e-37
Family Aromatic dioxygenase reductase-like 0.017
Further Details:      
 
Domain Number 2 Region: 107-274
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.86e-37
Family Ferredoxin reductase FAD-binding domain-like 0.0064
Further Details:      
 
Domain Number 3 Region: 37-126
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.42e-22
Family 2Fe-2S ferredoxin-related 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|152978284|ref|YP_001343913.1|
Sequence length 409
Comment Na(+)-translocating NADH-quinone reductase subunit F [Actinobacillus succinogenes 130Z]
Sequence
MDSNFIFGIGAFTAIVLVLAVVILIAKSKLVDSGDITISINDDPSKAITLPAGGKLLGAL
ASKGIFVSSACGGGGSCGQCRVKVKSGGGEILPTELSHISKKEAKEGWRLSCQVNVKSSM
DVELPEEVFGVKKWECTVISNDNKATFIKELKLAIPEGEEVPFRAGGYIQIEAEPHTVAY
KDFDIPEEYHEDWDKFNLWRYVSKVDEHIIRAYSMASYPEEKGIIMLNVRIATPPPRNPN
VPPGQMSSYIWSLKPGDKVTISGPFGEFFAKDTDAEMVFIGGGAGMAPMRSHIFDQLKRL
HSKRKISFWYGARSKREMFYVEDFDQLQAENPNFTWHVALSDPLPEDNWDGYTGFIHNVL
YENYLKNHEAPEDCEYYMCGPPVMNAAVIKMLEDLGVEHENILLDDFGG
Download sequence
Identical sequences A6VLY1
339671.Asuc_0604 gi|152978284|ref|YP_001343913.1| WP_012072358.1.63012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]