SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152978545|ref|YP_001344174.1| from Actinobacillus succinogenes 130Z

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152978545|ref|YP_001344174.1|
Domain Number 1 Region: 6-106
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.05e-29
Family 2Fe-2S ferredoxin-related 0.0000377
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|152978545|ref|YP_001344174.1|
Sequence length 113
Comment ferredoxin, 2Fe-2S type, ISC system [Actinobacillus succinogenes 130Z]
Sequence
MPKIVFLPNEEFCPEGMVVDAAAGDNLLEVAHNAGVEIHHACDGSCACTTCHVVIREGYD
SLNETSDQEEDMLDKAWGLEMESRLSCQCVIGDEDLVVEIPKYNINQVNEAAH
Download sequence
Identical sequences A6VMP2
339671.Asuc_0869 gi|152978545|ref|YP_001344174.1| WP_012072617.1.63012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]