SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152979145|ref|YP_001344774.1| from Actinobacillus succinogenes 130Z

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152979145|ref|YP_001344774.1|
Domain Number 1 Region: 3-85
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.01e-20
Family 2Fe-2S ferredoxin-related 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|152979145|ref|YP_001344774.1|
Sequence length 85
Comment ferredoxin [Actinobacillus succinogenes 130Z]
Sequence
MKIYRVHLTLTDSVITHSNRTSLLATLEANNVRHEYQCRSGYCGACRTKIKKGKVSYKET
PLAFMNPGEILLCCCQLESDVELEL
Download sequence
Identical sequences A6VPE2
2005219301 339671.Asuc_1481 WP_012073216.1.63012 gi|152979145|ref|YP_001344774.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]