SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152979251|ref|YP_001344880.1| from Actinobacillus succinogenes 130Z

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152979251|ref|YP_001344880.1|
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.31e-21
Family 2Fe-2S ferredoxin-related 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|152979251|ref|YP_001344880.1|
Sequence length 65
Comment ferredoxin [Actinobacillus succinogenes 130Z]
Sequence
MDLPYSCRAGSCSACVGKLVEGTVDQSDQSFLTEQQIQDGYVLLCVAYPTSDCVIYTHQE
ENLTN
Download sequence
Identical sequences A6VPP8
339671.Asuc_1591 gi|152979251|ref|YP_001344880.1| WP_012073322.1.63012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]