SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152979332|ref|YP_001344961.1| from Actinobacillus succinogenes 130Z

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152979332|ref|YP_001344961.1|
Domain Number 1 Region: 5-150
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 1.57e-52
Family Molybdopterin synthase subunit MoaE 0.00000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|152979332|ref|YP_001344961.1|
Sequence length 159
Comment molybdopterin biosynthesis MoaE protein [Actinobacillus succinogenes 130Z]
Sequence
MADIRIAVQEAEFDQNAEYRWLSENHSIGATTIFVGKVREMNLGDEVASLYLEHYPAMTE
KALREIVEEAKQRWDIQRISVIHRVGLLQTGDPIVLVGVSSAHRGDAYAANEFIMDYLKT
RAPFWKKEQTAQGERWLESRDSDHQAVGKWSREKRIERA
Download sequence
Identical sequences A6VPX9
WP_012073403.1.63012 gi|152979332|ref|YP_001344961.1| 339671.Asuc_1674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]