SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152979362|ref|YP_001344991.1| from Actinobacillus succinogenes 130Z

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152979362|ref|YP_001344991.1|
Domain Number 1 Region: 214-740
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 4.06e-197
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00000000043
Further Details:      
 
Domain Number 2 Region: 755-899
Classification Level Classification E-value
Superfamily ADC-like 6.63e-45
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.00037
Further Details:      
 
Domain Number 3 Region: 1-123
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.08e-34
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.003
Further Details:      
 
Domain Number 4 Region: 140-208
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000247
Family Ferredoxin domains from multidomain proteins 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|152979362|ref|YP_001344991.1|
Sequence length 935
Comment formate dehydrogenase subunit alpha [Actinobacillus succinogenes 130Z]
Sequence
MINLTIDGLNVQVEKGTTVLEAAKSAGINIPTLCYLKDVSNIGSCRVCVVEVDGYDKLPT
SCNTLAQDGMVVRTQTDRVVKSRRMALDLILSHHNLICFSCPSNGACELQNVCHQCGISE
SSYENIRVAGIEVPHVEDNPFLGYRPDLCIHCQRCINTCANVSGCDSIKLTSRGIFRTIE
TPFGKNWKETDCESCGNCAEACPTGAIYKKEAKSYRTWEISRVRTTCPHCAVGCQYELLV
KDNKLVGAEAVDGPSNGGRLCVKGRFGSYKFVMSGDRLTDPLIKDRATGKFRKASWEEAL
DLVASKFMALKRQYGPDSLAGFACSRSPNEDIYMVQKMVRTCFGTNNTDNCARVCHSASV
EGLAKTLGSGAMTNPIYDITHDVDAILLVGSNPEEAHPVIGMQIREAVRKGTKLIVVDPR
DIGLTKQADIHLKLRPGTNIAFANGMCHIFIKEGLIDEEFIAERTEGFKELKKIVKDYTP
ERVAKICGIDPDDLRAAARIYATAKKAPIIYCLGVTEHSTGTEGVMSMSNMAMSVGKLGR
EGCGVNPLRGQNNVQGACDMGAMPDKFPGYQPVTNPEIREKFEKAWGVKLPAHAGTHATD
IFPKAVKGEVKGLYIYGEDPVVTDPDTNHVVKALKALDFLVVQELFMTETALLADVVLPG
RSYAEKDGTFTNTERRVQRVRKAVTLPGNARLDTDIICELMRRMGYNQPTLTASEIFDEM
ASVTPSFHGMSYARLDNEPSQSLQWPCTDNYHAGTAIMHVGKMVRGLGLFYPTEYRPAKE
LPDKDYPLMLMTGRILYHYNTSAMTARTEGLMEIAGHSFVEINTEDAKSLDIADGERVSI
RSRRGCITSEARVSDKTNPGECWMPFHFADGNCNWLTNAALDQFARIPEYKVCACRIEKL
PKEEAFNAKGKYISQKMVAKQWRKRMDKNIARVLG
Download sequence
Identical sequences A6VQ09
WP_012073433.1.63012 339671.Asuc_1704 gi|152979362|ref|YP_001344991.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]