SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152979471|ref|YP_001345100.1| from Actinobacillus succinogenes 130Z

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152979471|ref|YP_001345100.1|
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 7.35e-30
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0000105
Further Details:      
 
Domain Number 2 Region: 107-239
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 1.15e-28
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.00000311
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|152979471|ref|YP_001345100.1|
Sequence length 255
Comment fumarate reductase iron-sulfur subunit [Actinobacillus succinogenes 130Z]
Sequence
MTNQVMNVEILRYNPETDKEPYLKTYQVPYDNQTSLLDALGYIKDRLEPELSYRWSCRMA
ICGSCGMMVNNIPKLACKTFLRDYSGHMRIEALANFPIERDLVVDLSHFIESLEAIKPYI
IGNKMPELDGQPHESAELQKSRTKQTPKQLEKYRQFSMCINCGLCYAACPQFGLNPEFVG
PAALTMAHRYNLDNRDNGKAERMPIINGDNGVWTCTFVGACSEVCPKHVNPAAAINQGKL
ESAKDFLISMLKPKA
Download sequence
Identical sequences A6VQB8
WP_012073542.1.63012 gi|152979471|ref|YP_001345100.1| 339671.Asuc_1814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]